TY - JOUR
T1 - Frog corticotropin-releasing hormone (CRH)
T2 - Isolation, molecular cloning, and biological activity
AU - Okada, Reiko
AU - Ito, Yoichi
AU - Kaneko, Miyoko
AU - Yamamoto, Kazutoshi
AU - Chartrel, Nicolas
AU - Conlon, J. Michael
AU - Vaudry, Hubert
AU - Kikuyama, Sakae
PY - 2005
Y1 - 2005
N2 - Corticotropin-releasing hormone (CRH) was isolated from the brain of the European green frog, Rana esculenta, by combining HPLC purification with radioimmunoassay (RIA) detection. The amino acid sequence SEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII was identical with the sequence of bullfrog (R. catesbeiana) CRH that was deduced from a cDNA encoding the CRH precursor. Synthetic frog CRH enhanced the release of thyroid-stimulating hormone (TSH) from dispersed bullfrog pituitary cells in a concentration- dependent manner. The TSH-releasing activity of a bullfrog hypothalamic extract was decreased by approximately 45% in the presence of the CRH receptor antagonist, α-helical CRH9-41, suggesting that CRH is one of the main TSH-releasing factors present in the bullfrog hypothalamus.
AB - Corticotropin-releasing hormone (CRH) was isolated from the brain of the European green frog, Rana esculenta, by combining HPLC purification with radioimmunoassay (RIA) detection. The amino acid sequence SEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII was identical with the sequence of bullfrog (R. catesbeiana) CRH that was deduced from a cDNA encoding the CRH precursor. Synthetic frog CRH enhanced the release of thyroid-stimulating hormone (TSH) from dispersed bullfrog pituitary cells in a concentration- dependent manner. The TSH-releasing activity of a bullfrog hypothalamic extract was decreased by approximately 45% in the presence of the CRH receptor antagonist, α-helical CRH9-41, suggesting that CRH is one of the main TSH-releasing factors present in the bullfrog hypothalamus.
KW - Bullfrog
KW - CRH
KW - TSH
KW - TSH-releasing factor
UR - http://www.scopus.com/inward/record.url?scp=22144452864&partnerID=8YFLogxK
UR - http://www.scopus.com/inward/citedby.url?scp=22144452864&partnerID=8YFLogxK
U2 - 10.1196/annals.1327.019
DO - 10.1196/annals.1327.019
M3 - Article
C2 - 15891019
AN - SCOPUS:22144452864
SN - 0077-8923
VL - 1040
SP - 150
EP - 155
JO - Annals of the New York Academy of Sciences
JF - Annals of the New York Academy of Sciences
ER -